PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008233242.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 214aa    MW: 25280.9 Da    PI: 5.8404
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008233242.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.86.9e-4331313128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyat.gkrknratksgyWkatgkdkevl 93 
                      GfrF Pt+eelv++yL+kk ++k+++++++i+e+di+k+ePwdLp    + ++  ++++fFs+rd ky +   r+nr+t +g+Wk tgk++ ++
  XP_008233242.1   3 CGFRFCPTEEELVNHYLRKKKQDKDFKVDHIIPEIDICKYEPWDLPGlftEPESPYQDMFFFSPRDYKYINnRARTNRVTGRGFWKITGKERVIK 97 
                     6***************************999***************6233333344588**********96378******************999 PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +  +g kktL+fy+gr  + ++t+Wvmhey l
  XP_008233242.1  98 G-ARGSIGRKKTLIFYEGRVTQCNRTNWVMHEYYL 131
                     9.7779***************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100546.0091156IPR003441NAC domain
SuperFamilySSF1019413.92E-463155IPR003441NAC domain
PfamPF023653.0E-244130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MDCGFRFCPT EEELVNHYLR KKKQDKDFKV DHIIPEIDIC KYEPWDLPGL FTEPESPYQD  60
MFFFSPRDYK YINNRARTNR VTGRGFWKIT GKERVIKGAR GSIGRKKTLI FYEGRVTQCN  120
RTNWVMHEYY LCEDEAIPNP KLAQQRDFVL CRLRKNAVKN VTSICAVAEP AYAEWLGISE  180
EECPQPEELE LVFPALQLQD NISEEMEFEI FSKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-35415520164NO APICAL MERISTEM PROTEIN
1ut4_B6e-35415520164NO APICAL MERISTEM PROTEIN
1ut7_A6e-35415520164NO APICAL MERISTEM PROTEIN
1ut7_B6e-35415520164NO APICAL MERISTEM PROTEIN
4dul_A6e-35415520164NAC domain-containing protein 19
4dul_B6e-35415520164NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233242.11e-160PREDICTED: NAC domain-containing protein 74-like
RefseqXP_008233243.11e-160PREDICTED: NAC domain-containing protein 74-like
SwissprotB5X5702e-43NAC14_ARATH; NAC domain-containing protein 14
TrEMBLM5X4E81e-122M5X4E8_PRUPE; Uncharacterized protein (Fragment)
STRINGAT1G33060.24e-41(Arabidopsis thaliana)
STRINGGLYMA16G01911.17e-43(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13710524
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.11e-44NAC 014